Mar
06
2014
0

studi lapangan seni sakral

SENI SAKRAL

DALAM KEBUDAYAAN BALI

Judul               : FilsafatSeniSakralDalamKebudayaan Bali

Pengarang       : I MADE YUDABAKTI dan I WAYAN WATRE

Penerbit           : PARAMITA Surabaya

Tebal               : 120 halaman

 

SeniSakraladalahsebuahkesenian yang lahirnyadariperjuangan rasa baktimanusiauntukdipersembahkankehadapanTuhan Yang MahaEsa.Demikianbesar rasa baktimanusia, laludiwujudkandalambentukkaryasenisepertitari, tabuh, suara, senirupa, danpedalangan.Untukmenguatkanperjuanganbaktimerekapadaleluhurdan Ida Sang HyangWidhiWasa, hasilkaryaseni yang berhasilmerekawujudkandiperkuatdalamsebuahmetologiatausejarah.Sehinggaseniituselalumenjadisakralsepanjangmasa.Semuakaryaseni yang merekaanggapsakraldituangkandalambeberapalontarseperti : PurwagamaSesana, Barong Swari, Usana Bali, Japa Kala, Kala Purana, TantuPagelaran, Kecacar, Dharma Pewayangan, Siwanataraja, dan lain sebagainya. Lalu, bagaimanajikakalaukeseniansakraljikatidakbersumberpadatatwa agama?ApafungsiseniSakral? Apaterkaitdenganfilsafat? Hal-halituakandibahasdalambuku yang ditulisoleh I Made Yudabaktidan I WayanWatra, FilsafatSeniSakraldalamKebudayaan Bali.

Di dalambukuinitidakhanyamemberitahukantentangsenisakralpadapembaca.Namunjugamemberitahukanfilsafatseni, pengertianseni, fungsikesenian, sejarah/ sumbersenisakraldanjenis-jenissenisakral.Bukuinipatutdiacungijempolkarenaberkatbukuini, banyakpendapatdarimasyarakatatausipembaca yang mengakuibahwabukuini, bisamemeberikanpenegetahuanpadamasyarakatawammengenaisenisakral, mulaidarilatarbelakang,  sejarahdanseluruhkeseniansakral yang ada di Bali.

Meskipenulistidakmembuatsemuatentangseni, tapiada yang dijadikanbeberapapoin, makadariitujustrulebihmudahbagisipembacauntukmemahamiisidaribukutersebut, danmudahdicerna.  Kelebihanlaindaribukuiniyaitudilengkapijugadengangambarsenisakral. Seperti: gambar-gambartarian-tariansakral yang di pentaskanpadasaatupacara agama Hindu, danjugagambartokohpewayangan yang adapadaceritasakral (sapulegerdansudhamala) yang bisamembuatpembacamenjaditertarikuntukmembacanyadansipembacamengetahuitokoh-tokoh yang adadalamsenisakral. Jadi, pembacatidakmerasabosankalamembacabukuini.

Dalambukuinidisuguhkanbeberapapedomanmengenaisumberdarisenisakraltersebut.Seperti: diambildarilontar Barong Swaridisebudkanataudisinggunkantentangterjadinyatarian Barong, Telek, danTopeng. LontarKecacardanTantuPegelarandisebutkantentangmithologitariSanghyangDedari.LontarPrakempadisebutkansemuabarungan gamelan mempunyaifungsi yang berlainansesuaidengantempat, waktu, dankondisi.Dan lontar yang lainnya yang berkaitandengansenisakral.

Dalambukuinidijelaskanjugamengenaitigafungsiseni, yakniseperti: SeniWali, yaituseni yang dipentaskankhususpadaharisuci, tempatsucidanbagianseninyatelahditentukanolehsuatukeputusansastra, seperti :TariRejang, Pendet, Sanghyang, Baris, danWayangSapuleger. SeniBebali, yaituseni yang dipentaskanuntukmengiringiupacarayadnya di Pura-puraatau di luarPura.CirikhaskesenianBebaliadalahpentasseni yang memakailakon.Adapusenitersebutantara lain: SeniPewayangan, Topeng, sertaberbagaiseni yang diciptakanberlandaskanketigasenitersebut di atas. SeniBalih-balihan, yaituseni yang mutlakdiperuntukansebagaihiburanatautontonanmasyarakat. Adapunsenitersebutantaralainadalahsemuacabangseniselain yang tersebutpadabutir di atas (butirSeniWali, danBebali).

Bukuinipadabagianakhirnyajugadilengkapidengankesimpulantentangisibukudariawalsampaiakhirdirangkummenjadiduahalaman.Namun, di sisikekuranganpadabukuini, penuliskurangmenjelaskansecara detail tentangKarawitan yang mengiringipementasansenisakraltersebut.Penulishanyamenuliskantentangfilsafattersebut.

Denganmemahamifungsikesenian Bali secarabenar, makaakandiketahui pula beberapajumlahjenis-jeniskesenian Bali dalamsetiapcabangseni. Jenisseni di Bali sangatlahbanyakdanberanekaragam. Yang termasukjenistersebutadalahsepertiSeniTari (Pedet, Rejang, Sanghyang, Baris), Wayang (WayangLemah, WayangSapuleger, WayangSudamala), TopengSidhakarya (Pajegan), SeniKarawitan ( Gong, Angklung, Saron, Gambang, Selonding, SemarPagulingan, Gender Wayang), SeniRupa (LukisParba, Pratima, Senjata/ Keris/ Tombak).

Dari sekianbanyakdijelaskan, menurutpendapatsaya, sajian yang dijelaskandalambukuinisangatlahmenarik, di manadijelaskansenisakral yang ada di Bali, sejarah/ sumbersenisakral, fungsikesenian Bali,  jenis-jeniskesenian Bali di dalambuku “FILSAFAT SENI SAKRAL DALAM KEBUDAYAAN BALI”.

 

Written by in: Tak Berkategori |
Mar
06
2014
0

karawitan kontemporer

MUSIK KARAWITAN KONTEMPORER

Jika seseorang ditanya tentang jenis musik yang diketahuinya,hampir dapat dipastikan dia akan menyebut jenis-jenis musik sepertyi : pop,jazz,klasik,dang dut,keroncong.Pendek kata,jenis musik yang memang akrab menjadi perbincangan masyarakat umum.Jarang orang menyebut jenis musik kontemporer.Dan memang begitulah keberadaan musik kontemporer.Memiliki kesejatian namun seolah “mengambil jarak” dari hiruk pikuk kesemestaan musik,khususnya musik industri.

Musik kontemporer sebetulnya adalah musik yang contempo(rary).Keberadaannya berpaut erat dengan mengalirnya waktu atau tempo.Itulah mengapa musik kontemporer sering juga disebut musik garda depan (avantgarde).Karena musik tersebut senantiasa mengedepani sebuah era.Musik kontemporer lazim juga menyandang sebutan new musik atau musik baru.(namun bukan genre musik new age).Dikarenakan sebagai konsekuensi keberadaannya yang senantiasa mengedepani sebuah era,musik kontemporer “dituntut” untuk menghadirkan sesuatu yang baru.

Beberapa orang sering menganggap bahwa musik kontemporer adalah produk dari modernisasi.Atau salah satu pengejawantahan era modern.Sebetulnya,nilai kekontemporeran dalam musik sudah dikenal sejak jaman Johann Sebastian Bach.Pada jamannya,musik Bach sudah dianggap sebagai musik kontemporer.Komposisi musik Bach yang bagai air mengalir tanpa jeda,ditambah gaya kontrapung(alur bass dan melodi saling kontra membentuk aliran harmoni),merupakan sebuah komposisi yang jauh melampaui kelaziman saat itu.Untuk musik kontemporer sebagai sebuah genre musik yang mandiri,keberadaannya mulai marak setelah berakhirnya perang dunia II.Dipelopori oleh Arnold Schonberg dengan tangganada duodekatonik atau 12 nada. Tangga nada yang umum dikenal adalah diatonik,terdiri dari 7 nada.( do re mi fa so la si).Juga musik dengan teknik garapan yang menggunakan idiom dan tata gramatika matematika dari Pierre Boulez.Olivier Messiaen dengan teknik garapan musik berupa perbandingan geometri bangunan.Kemudian musik perkusi dari John Cage dan banyak lagi pemusik yang merupakan pelopor musik kontemporer di dunia.Untuk kawasan Asia,harus disebut nama Nam June Paik dari Korea.

 

  1. 1.      Musik Karawitan Kontemporer

 

Kata kontemporer berasal dari contemporary ( bhs inggris), sebagai kata benda dapat berarti sezaman, sebaya, atau seumur, sedangkan dalam kata sifat adalah zaman sekarang. Dalam konteks zaman sekarang dapat diperluas yang mengarah sifat- sifat masa kini.

Sementara kata gamelan adalah seperangkat alat musik tradisional jawa, Bali, Sunda, dan lain-lain yang menggunakan sistem laras pentatonik, yaitu slendro pelog. Untuk kalangan musik internasional mengartikan gamelan tidak semata-mata sebagai alat, melainkan sebagai kesatuan sistem musikal yang diwujudkan dalam berbagai karakter dan bentuk garapan yang sangat komplek dan kalangan seniman kita sepakat dipahami dengan istilah karawitan.

Merujuk pernyataan di atas bahwa dunia kontemporer merupakan suatu penomena kehidupan yang terjadi sebagai akibat dari industrialisasi (negara barat) dan pembangunan di negara- negara berkembang/ dunia ke 3. Dan musik kontemporer merupakan bagian yang tak terpisahkan dengan kontemporer itu, yaitu meliputi berbagai gaya musik yan eksis dijamannya baik sebagai perwujudan langsung dari alam pemikiran modern (abad XX) maupun merupkan kelanjutan dari masa lampau. Sebagai anologi yang lebih tepat Musik karawitan kontemporer digolongkan sebagai salah satu gaya musik dunia.

 

  1. 2.      Perkembangan Musik Karawitan Kontemporer

Tahun 1970 adalah saat masa penting dalam sejarah perkembangan seni karawitan Bali. Pada waktu itu muncul garapan karawitan kontemporer Bali, garapan karawitan modern yang eksperimental sifatnya namun masih bersumber dan berakar pada musik tradisi.

Awal pertumbuhan karawitan kontemporer Bali ditandai oleh garapan musik berjudul Gema Eka Dasa Rudra karya I Nyoman Astita pada tahun 1979. Dalam garapan karawitan ini Astita mencoba menuangkan interpretasinya terhadap suasana musikal dari serangkaian upacara ritual dalam karya Agung Eka Dasa Rudra di Besakih tahun 1978. Barungan gamelan yang dijadikan dasar adalah Semar Pagulingan yang dikembangkan dengan jalan menambah beberapa buah gong dan kempul, cengceng kopyak, kentungan (alat menumbuk padi), kulkul (kentongan), serta sapu lidi. Dengan alat-alat ini Astita menyajikan sedikitnya 5 warna musik Bali : Semar Pagulingan, Gong Kebyar, Balaganjur, Angklung dan Gong Beri untuk melukiskan jalannya upacara Eka Dasa Rudra.

Di samping memadukan alat-alat gamelan dengan alat-alat yang non gamelan, Gema Eka Dasa Rudra lahir dengan menawarkan dua gagasan baru.

  • Pertama dalam garapan dilakukan beberapa perubahan patet gending dan merangkai lagu-lagu yang berlaras Pelog dengan Slendro. Struktur nada gamelan Semar Pagulingan Saih Pitu memungkinkan untuk melakukan semuanya ini. Oleh karena itu dalam kreasi musik ini ada lagu-lagu yang dimainkan dalam patet selisir, patet tembung dan lain-lainnya. Laras Slendro muncul ketika diperdengarkan lagu-lagu gamelan Angklung dan laras Pelog terdengar pada waktu Balaganjur dan Kakebyaran.
  • Kedua, sepanjang perjalanan musik Gema Eka Dasa Rudra ini para pemain menabuh atau menyanyi sambil menari. Dengan gerak-gerak yang sederhana, para penabuh mencoba untuk menvisualkan beberapa aktivitas yang terjadi dalam upacara Eka Dasa Rudra yang sesungguhnya. Dengan demikian Gema Eka Dasa Rudra menjadi sebuah sajian musik yang sifatnya audio-visual yang menarik untuk dilihat dan didengar.

Munculnya Gema Eka Dasa Rudra yang dipersiapkan untuk Festifal Komponis Muda di TIM Jakarta ini mendapat sambutan positif dari kalangan pengamat dan budayawan Bali, sehingga merangsang tumbuhnya karya-karya karawitan kontemporer lainnya. Di antara karya-karya penting yang muncul sesudahnya adalah

Judul Oleh
Uma Sadina Nyoman Astita
Trompong Beruk Wayan Rai S
Sumpah Palapa Nyoman Windha
Kosong Ketut Gede Astawa

Kehadiran karya-karya ini membuat semakin semaraknya kehidupan seni karawitan kontemporer didaerah Bali.

  1. 3.      Ciri- ciri musik kontemporer

Musik kontemporer,dapat dikenali dengan beberapa ciri yang hampir senantiasa melekat dalam kehadirannya.

  • Judul : Karya musik kontemporer lazim menggunakan judul yang aneh dan bahkan asing.Seperti misalnya Gymnopedie,Liturgi kristal,Telemusik.Dan ada juga yang menggunakan bahasa yang sudah tidak lazim,seperti judul karya Steve Reich,Tehilin.
  • Tema : Dalam musik yang lazim dikenal,tema yang diangkat umumnya berkisar pada cinta,duka,gembira.Musik kontemporer mengusung tema yang seringkali “baru”.Misalnya Tetabuhan Sungut karya Slamet Abdul Syukur,yang mengusung tema eksplorasi kemampuan bunyi mulut manusia.
  • Instrumentasi : Dalam musik kontemporer,bukan hanya instrumen musik yang lazim dikenal saja,melainkan juga digunakan benda-benda yang menghasilkan bunyi,Misalnya generator gelombang bunyi dalam karya Stockhausen.Musik dari Tepukan Tangan karya Steve Reich.Dan piano yang disumbat dengan sekrup dan benda-benda logam karya John Cage
  • Partitura : Untuk musik kontemporer,notasi balok dan/atau angka,tidaklah cukup.Konsep musik dalam musik kontemporer seringkali harus disertai petunjuk yang detail tentang gambaran bunyi dan cara memproduksi bunyi tersebut.Itulah mengapa dalam ranah musik kontemporer dikenal pula notasi auditif dan notasi tindakan
  • Teknik garapan : Seringkali,komponis musik kontemporer membuat sendiri tata gramatika dan idiom musiknya.Juga susunan dan struktur harmoni yangt baru.Ide garapan dapat saja menggunakan idiom dan tata gtramatik musik tradisi.Atau juga perhitungan nilai matematis dan dapat pula ratio atau perbandingan sebuah struktur rancangan bangunan.
  1. 4.      Keberadaan Musik Kontemporer di Indonesia

Keberadaan musik kontemporer di Indonesia dapat dirunut setelah berakhirnya perang kemerdekaan.Meskipun pada era perang kemerdekaan,komponis sekaligus pianis Amir Pasaribu telah merevitalisasi lagu-lagu tradisional Indonesia untuk keperluan permainan solo piano klasik.Secara umum,menurut kajian Prof Dieter Mack,komposer,pianis dan pakar tentang budaya musik Indonesia dari Universitas Freiburg Jerman,keberadaan musik kontemporer di Indonesia dapat dibagi menjadi :

  • Musik kontemporer dalam idiom tradisi barat.Termasuk dalam kategori ini adalah komponis Amir Pasaribu,Dua Srikandi piano : Trisutji Kamal dan Marusya Nainggolan Abdullah.Materi garapannya dapat berupa musik tradisional.Namun teknik garapannya memakai prinsip-prinsip yang lazim di kenal pada musik barat.Misalnya nuansa gendhing gamelan Jawa yang ditranskripsikan ke dalam piano.Sudah tentu,masalah laras dan alur musiknya bukan lagi pelog,slendro ataupun ladrang.melainkan misalnya mengambil bentuk sonata,prelude dan semacamnya
  • Musik kontemporer yang bersumber dari unsur etnik.Kategori ini dimotori oleh nama-nama seperti : A.W.Sutrisna,Rahayu Supanggah,Wayan Sadra,Dody Satya Ekagust Diman,komponis muda yang banyak mendapat pujian di Jerman.Karya dalam kategori ini dapatlah dikatakan sebuah revitalisasi musik tradisi.Misalnya,Degung Sunda yang diberi “baju” baru.Berupa cara menabuh dengan teknik baru misalnya dengan sendok makan,Cara memetik kecapi dengan menggunakan gesekan kuku jari.Tata gramatik musikpun mendapat pakem baru.Misalnya perubahan fungsi tiap instrumen.Juga kemungkinan peran sebagai solis pada tiap instrumen.Degung klasik yang murni adalah sebuah ensemble permainan musik bersama.Musik baru yang berlatar belakang budaya Indonesia dan budaya Barat.Komponis terkemuka dalam kategori ini adalah : Slamet Abdul Syukur,Alm.Sapto Ragardjo,Alm.Ben Pasaribu,Tony Prabowo,Oto Sidharta.Ciri garapan kategori ini adalah mix culture,Percampuran dua macam budaya.Misalnya karya Slamet Abdul
  • Syukur yang berjudul Tetabuhan Sungut.Adalah sebuah canon vocal.Namun strukturnya mengambil teknik garapan gendhing.

Para komponis musik kontemporer di Indonesia,membentuk sebuah forum komunikasi yang disebut Asosiasi Komponis Indonesia (AKI).Kiprah Indonesia di forum musik kontemporer dunia sebetulnya dapat dikatakan lumayan.mas Slamet Abdul Syukur termasuk komponis papan atas international.Begitu juga dengan Tony Prabowo dan Dody Satya Ekagust Diman.Dalam Liga Komponis Asia Pasifik pun Indonesia senantiasa berkiprah.Saya sendiri pernah mewakili Indonesia bersama Dody Satya Ekagust Diman dalam The 20th Asia Pacific Composer League Festival and Conference 1999.Pendidikan para komponis muda dalam musik kontemporer pun masih tetap intens dilakukan.Salah satu hasil dari pendidikan tersebut adalah lahirnya sebuah kelompok yang menamakan diri The Circle.Sebuah kelompok beranggotakan 9 komponis musik kontemporer.Mereka tergolong komponis belia.Pada 22 Januari 2011 mendatang,mereka akan menggelar konser di Komunitas Salihara Jakarta.Konsernya berjudul PHI.Akan ditampilkan 11 komposisi kontemporer untuk piano,alat tiup dan alat elektronik

  1. 5.      Estetika dalam Bentuk musik karawitan Kontemporer di Bali.

Seni dewasa ini tidak hanya dipahami sebagai produk rasa, melainkan juga mencerminkan kemampuan intelektual manusia. Pada mulanya seniman jarang menjadikan seni sebagai wacana, ia lebih banyak mencipta dan melakukannya. Namun merujuk pada pemahaman yang terus berkembang dan munculnya filsafat ilmu pengetahuan modern, banyak filsuf professional maupun seniman mulai membicarakan makna “seni”, “pengalaman estetik”, “kebenaran artistik”, yang dipergunakan dalam wacana-wacana seni. Namun satu hal yang paling mengejutkan adalah betapa sulitnya para filsuf dan seniman membuat batasan-batasan istilah dalam seni, karena ketika menganalisis apa yang mereka maksudkan hasilnya sering tidak konsisten pertautannya, sehingga perlu dipahami secara mendalam.

Salah satu misalnya wacana tentang seni dan keindahan. Pendapat yang paling bersahaja dan sering kita dengar bahwa semua yang indah adalah seni, atau sebaliknya bahwa semua seni itu indah dan yang tidak indah bukanlah seni; kejelekan berarti ketiadaan seni. Identifikasi seni dan keindahan seperti ini adalah dasar dari kesukaran kita dalam memberikan apresiasi terhadap seni. Bahkan pada orang-orang yang nyata-nyata sensitif terhadap segi-segi estetikpun anggapan ini merupakan sensor yang tidak disadari pada saat berhadapan dengan hasil seni yang kebetulan tidak indah. Baik pandangan historis yang meneliti bagaimana hasil-hasil seni di masa silam maupun pandangan sosiologis dengan memahami bagaimana manifestasi seni sekarang ini di berbagai tempat di dunia ternyata bahwa hasil seni sering merupakan sesuatu yang tidak indah.

Pada musik kontemporer misalnya, kita sering dihadapkan pada kenyataan bahwa musik komtemporer tidak selalu bisa kita nikmati sebagai sesuatu yang indah dan menyenangkan. Bahkan sebaliknya banyak karya-karya musik kontemporer membuat penontonnya jengkel, bosan, bahkan marah yang berakhir dengan kecaman. Namun apakah yang demikian itu tidak bisa kita golongkan kedalam sebuah karya seni, inilah pertanyaan yang akan ditelusuri lewat pemikiran baru, lewat paradigma baru sebagai dampak arus perkembangan intelektual manusia masa kini.

Dalam tulisan ini saya akan melakukan kajian estetika pada dua karya musik yang lahir di Bali yaitu “Mule Keto” (1987) dan “Gerausch” (2005). Kedua karya ini, sesuai dengan yang diperkenalkan oleh penciptanya adalah karya musik yang digarap dengan konsep komtemporer. Namun demikian kedua karya ini memiliki perbedaan orientasi dalam memaknai dan menerapkan konsep kontemporer, yang satu berubah secara bertahap dalam bingkai yang lentur sedangkan yang satu melakukan perubahan radikal, bahkan melampau batas-batas konseptual sebuah karya musik. Karya yang satu dapat memberikan rasa senang, sedangkan yang satu menjengkelkan, kenapa? Inilah permasalahan yang dicoba dibahas dengan menggunakan prinsip dan alur pemikiran postmodern. Bersandar pada pendapat bahwa seni adalah bagian dan unsur terpenting dari kebudayaan, maka dengan mencoba memahami kerangka berfikir setiap era/jaman (pra modern, modern, postmodern), maka kehadiran seni yang kebetulan tidak menyenangkan dapat dijelaskan

Written by in: Tak Berkategori |
Mar
06
2014
0

pelegongan

PAPARAN TETANG GAMELAN PELEGONGAN

Gambelan pelegongan yaitu salah barungan gamelan Bali yang biasanya dipakai untuk mengiringi tarian legong keraton. Kesatuan barungan ini terdiri dari pada jumlah alat-alat yang mempunyai nama-nama tersendiri dan fungsi terhadap kesatuan barungannya. Jenis alat yang pernah dipakai atau samapai kini masih dipergunakan untuk menjadikan barungan gamelan pelegongan itu antara lain:

  1. Gender rambat berbilah 13/14/15 dua tungguh.
  2. Gender barangan berbilah sama dengan yang diatas.
  3.  Jegogan bebilah 5 dua tunggug
  4. Penyacah berbilah 5 dua tungguh.
  5. Jublag berbilah 5 dua tungguh.
  6. Gangsa jongkok berbilah 5 empat tungguh.
  7. Ceng-ceng satu pangkon.
  8. Kajar satu buah.
  9. Klenong satu buah.
  10. Kemong satu buah
  11. Kendang krumpungan dua buah.
  12. Suling besar dua buah
  13.  Rebab satu buah
  14. Genta Orag.
  15. Gong satu buah

Gamelan pelegongan itu kalau dilihat bangun instrumennya kemudian bentuk-bentuk lagunya yang menunjukan ciri-ciri keasliannya ,maka dapatlah diyakinkan bahwa gamelan pelegongan itu tidak termasuk pada kelompok gamelan-gamelan jaman kuno (gamelan tua) di Bali. Gamelan pelegongan itu baru ada setelah adanya gamelan semar pegulingan yang berlaras pelog tujuh nada.

 

Written by in: Tak Berkategori |
Mar
06
2014
0

GONG KEBYAR

GONG KEBYAR

Dalam tulisan-tulisan mengenai gamelan bali terdahulu secara umum telah dikemukakan oleh masing-masing penulisnya bahwa gamelan gong kebyar ini baru muncul pada permulaan abad XX, yang pertama kali diperkirakan muncul di daerah Bali Utara tepatnya sekitar tahun 1915 di desa Jagaraga.

Namun kenyataan yang diungkapkan oleh Beryl de Zoete dan Walter Spies dalam bukunya yang berjudul “ Dance and Drama in Bali “ mengatakan bahwa I Ketut Mario yang sudah lahir sekitar tahun 1900 sudah menari sisia dalam calonarang di tahun 1906. Dalam ungkapan selanjutnya sama sekali tidak ada menyinggung masalah gong kebyar atau tari kekebyaran. Dari ungkapan ini kiranya dapat diketahui bahwa Bapak I Ketut Mario yang dikenal sebagai salah seorang tokoh dalam gong kebyar sampai dengan 1906 ( perang puputan Badung ) masih menjadi penari sisia dalam pencalonarangan yang dapat diartikan bahwa sampai tahun 1906 itu Bapak Mario belum mengenal tari kebyar dan berarti bahwa gamelan gong kebyar belum ada pada tahun 1906 itu. Menurut Colin McPhee dalam bukunya “ Musik in Bali ” ada menyebutkan bahwa untuk pertama kalinya gamelan gaong kebyar diperdengarkan didepan umum adalah pada bulan Desember 1915 dimana ketika itu tokoh-tokoh gong Bali Utara mengadakan kompetisi yang pertama kali untuk gong kebyar di Jagaraga. Colin McPhee sendiri mengakui bahwa apa yang dikemukakan itu adalah hasil interviunya dengan A.A Gde Gusti Jelantik mantan Regen Buleleng ( Colin McPhee, 1966 : 328 ). Apabila diperhatikan baik-baik apa yang dikemukakan Colin McPhee maka akan nampak bahwa tahun 1915 itu adalh saat kompetisi yang pertama kali di Bali Utara yang menampilkan bentuk-bentuk kekebyaran dan sudah tentu sekaa-sekaa yang ikut ambil bagian dalam kompetisi ini sudah menciptakan bentuk-bentuk kekebyaran satu atau dua tahun sebelumnya bahkan mungkin beberapa tahun sebelumnya. Adalah mustahil apabila gong-gong yang ditampilkan dalam kompetisi di tahun 1915 dengan mengambil tempat Di Jagaraga itu menciptakan bentuk-bentuk kekebyaran beberapa jam atau beberapa hari sebelumnya. Lain dari pada ungkapan Colin McPhee ini dapat diketahui juga bahwa desa Jagaraga yang selama ini dianggap sebagai daerah asal mula munculnya gamelan gong kebyar di Bali Utara pada tahun 1915 ternyata hanya dijadikan tempat kompetisi gong kebyar pada tahun 1915 tersebut di atas. Berdasarkan apa yang dikemukakan oleh Beryl de Zoete, Walter Spies dan Colin McPhee diatas maka kiranya dapat ditarik suatu batas pemunculan gong kebyar di Bali yakni diantara tahun 1906 sampai tahun 1915 dengan kata lain sesudah tahun 1906 dan sebelum tahun 1915 dan tempat pemunculannya pertama kali bukan di desa Jagaraga .

Setelah ditelusuri lebih mendalam, didapatkanlah beberapa data yang dapat dijadikan suatu pegangan guna mengetahui asal mula dari pada gamelan gong kebyar ini. Informasi pertama datangnya dari Bapak I Nyoman Rembang seorang guru karawitan pada Sekolah Menengah Karawitan Indonesia ( SMKI ) Denpasar yang dulunya bernama KOKAR Bali, mengatakan bahwa berdasarkan hasil wawancaranya dengan Bapak I Gusti Bagus Sugriwa yang berasal dari desa Bungkulan Buleleng mengatakan bahwa lagu-lagu gong kebyar diciptakan pertama kali oleh I Gusti Nyoman Panji di desa Bungkulan pada tahun 1914 dan ketika itu dicoba untuk ditarikan oleh Ngakan Kuta yang berdomisili di desa Bungkulan. Informasi ini menunjukan bahwa pada tahun 1914 di desa Bungkulan telah diciptakan lagu-lagu kekebyaran. Hanya saja belum diketahui bagaimana bentuk lagu kebyar yang diciptakan ketika di Bungkulan itu dan bagaimana pula bentuk gamelan gong kebyar yang telah menampilkan motif-motif kekebyaran itu.

Selanjutnya I Gusti Bagus Arsaja, BA. ( guru SMKI ) Denpasar dalam kertas kerja bandingannya ats kertas kerja dari Bapak I Wayan Dibia yang berjudul Sejarah Perkembangan Gong Kebyar di Bali, mengatakan bahwa di desa Bungkulan telah diciptakan lagu-lagu ( tabuh ) kekebyaran sekitar tahun 1910. Apa yang dikemukakan oleh I Gusti Bagus Arsaja, BA. ini bila dihubungkan dengan adanya kompetisi gong kebyar di Jagaraga tahun 1915 ternyata dapat selisih waktu lima tahun. Batas waktu tersebut kiranya batas waktu yang masuk akal oleh karena sampainya suatu sekaa kepad arena kompetisi adalah cukup memakan waktu untuk pematangannya. Waktu empat sampai lima tahun untuk proses pemantapan kiranya dapat diterima.

Berdasarkan uraian diatas beserta beberapa argumentasi sebagaimana dikemukakan diatas keranya telah dapat ditarik suatu kesimpulan bahwa gamelan gong kebyar pertama kali muncul di Bali Utara ( Buleleng ) sekitar tahun 1914 di desa Bungkulan dan bentuk-bentuk kekebyaran sudah diciptakan antara tahun 1910 sampai 1914 yang dipelopori oleh I Gusti Nyoman Panji.

Musik tradisional Bali memiliki kesamaan dengan musik tradisional di banyak daerah lainnya di Indonesia, misalnya dalam penggunaan gamelan dan berbagai alat musik tabuh lainnya. Meskipun demikian, terdapat kekhasan dalam teknik memainkan dan gubahannya, misalnya dalam bentuk kecak, yaitu sebentuk nyanyian yang konon menirukan suara kera. Demikian pula beragam gamelan yang dimainkan pun memiliki keunikan, misalnya gamelan jegog, gamelan gong gede, gamelan gambang, gamelan selunding dan gamelan Semar Pegulingan. Ada pula musik Angklung dimainkan untuk upacara ngaben serta musik Bebonangan dimainkan dalam berbagai upacara lainnya.

Terdapat bentuk modern dari musik tradisional Bali, misalnya Gamelan Gong Kebyar yang merupakan musik tarian yang dikembangkan pada masa penjajahan Belanda serta Joged Bumbung yang mulai populer di Bali sejak era tahun 1950-an. Umumnya musik Bali merupakan kombinasi dari berbagai alat musik perkusi metal (metalofon), gong dan perkusi kayu (xilofon). Karena hubungan sosial, politik dan budaya, musik tradisional Bali atau permainan gamelan gaya Bali memberikan pengaruh atau saling memengaruhi daerah budaya di sekitarnya, misalnya pada musik tradisional masyarakat Banyuwangi serta musik tradisional masyarakat Lombok.

Gong Kebyar adalah sebuah barungan baru. Sesuai dengan nama yang diberikan kepada barungan ini (Kebyar yang bermakna cepat, tiba-tiba dan keras) gamelan ini menghasilkan musik-musik keras dan dinamis. Gamelan ini dipakai untuk mengiringi tari-tarian atau memainkan tabuh-tabuhan instrumental. Secara fisik Gong Kebyar adalah pengembangan kemudian dari Gong Gede dengan pengurangan peranan, atau pengurangan beberapa buah instrumennya. Misalnya saja peranan trompong dalam Gong Gebyar dikurangi, bahkan pada tabuh-tabuh tertentu tidak dipakai sama sekali, gangsa jongkoknya yang berbilah 5 dirubah menjadi gangsa gantung berbilah 9 atau 10 . cengceng kopyak yang terdiri dari 4 sampai 6 pasang dirubah menjadi 1 atau 2 set cengceng kecil. Kendang yang semula dimainkan dengan memakai panggul diganti dengan pukulan tangan.

Secara konsep Gong Kebyar adalah perpaduan antara Gender Wayang, Gong Gede dan Pelegongan. Rasa-rasa musikal maupun pola pukulan instrumen Gong Kebyar ada kalanya terasa Gender Wayang yang lincah, Gong Gedeyang kokoh atau Pelegonganyang melodis. Pola Gagineman Gender Wayang, pola Gegambangan dan pukulan Kaklenyongan Gong Gede muncul dalam berbagai tabuh Gong Kebyar. Gamelan Gong Kebyar adalah produk kebudayaan Bali modern. Barungan ini diperkirakan muncul di Singaraja pada tahun 1915 (McPhee, 1966 : 328). Desa yang sebut-sebut sebagai asal pemunculan Gong Kebyar adalah Jagaraga (Buleleng) yang juga memulai tradisi Tari Kebyar. Ada juga informasi lain yang menyebutkan bahwa Gong Kebyar muncul pertama kali di desa Bungkulan (Buleleng). Perkembangan Gong Kebyar mencapai salah satu puncaknya pada tahun 1925 dengan datangnya seorang penari Jauk yang bernama I Mario dari Tabanan yang menciptakan sebuah tari Kebyar Duduk atau Kebyar Trompong.

Gong Kebyar berlaras pelog lima nada dan kebanyakan instrumennya memiliki 10 sampai 12 nada, karena konstruksi instrumennya yang lebih ringan jika dibandingkandengan Gong Gede. Tabuh-tabuh Gong Kebyar lebih lincah dengan komposisi yang lebih bebas, hanya pada bagian-bagian tertentu saja hukum-hukum tabuh klasik masih dipergunakan, seperti Tabuh Pisan, Tabuh Dua, Tabuh Telu dan sebagainya.

Lagu-lagunya seringkali merupakan penggarapan kembali terhadap bentuk-bentuk (repertoire) tabuh klasik dengan merubah komposisinya, melodi, tempo dan ornamentasi melodi. Matra tidak lagi selamanya ajeg, pola ritme ganjil muncul di beberapa bagian komposisi tabuh.

Barungan Gong Kebyar bisa diklasifikasikan menjadi 3 :

Utama = Yang besar dan lengkap

Madya = Yang semi lengkap

Nista = Yang sederhana

 

Barungan yang utama terdiri dari:

Jumlah Satuan Instrumen

10        buah    gangsa berbilah (terdiri dari 2 giying / ugal, 4 pemade, 4 kantilan)

2          buah    jegogan berbilah 5 – 6

2          buah    jublag atau calung berbilah 5 – 7

1          tungguh           reyong berpencon 12

1          tungguh           terompong berpecon 10

2          buah    kendang besar (lanang dan wadon) yang dilengkapi dengan 2 buah kendang kecil

1          pangkon          cengceng

1          buah    kajar

2          buah    gong besar (lanang dan wadon)

1          buah    kemong (gong kecil)

1          buah    babende (gong kecil bermoncong pipih)

1          buah    kempli (semacam kajar)

1-3       buah    suling bambu

1          buah    rebab

 

Written by in: Tak Berkategori |
Mar
06
2014
0

biografi seniaman

Ida Bagus Gede Surya Peradantha SSn.,

Pada tanggal 5-7 Juli 2011, Kementerian Kebudayaan dan Pariwisata Republik Indonesia, mengadakan sebuah acara penghargaan tahunan yang diberikan kepada mereka yang tekun dan sungguh-sungguh mengabdi di dunia seni budaya.  Ada empat kategori yang disediakan oleh Kemenbudpar RI kali ini yauti : 1. Bidang Maestro Seni Budaya, 2. Bidang Pelestari dan Pengembang Warisan Budaya, 3. Anugerah Seni dan 4. Anak/Remaja/Pelajar yang Berprestasi di Bidang Seni Budaya.

Masyarakat Bali saat ini pantas berbangga diri, karena salah satu putra-putri terbaiknya di bidang seni tari kembali mendapat penghargaan bergengsi tingkat nasional oleh pemerintah pusat di Jakarta. Acara bertajuk “Penghargaan Maestro Seni Tradisi dan Anugerah Kebudayaan Tahun 2011” ini diberikan kepada mereka yang telah berjasa dan mendedikasikan dirinya di bidang seni budaya. Setelah tahun lalu (2010) seniman Bali I Made Sija menerima penghargaan dari pemerintah pusat, kali ini adalah (alm.) Jero Puspawati, seniwati dramatari Arja, dari Geriya Bongkasa, Abiansemal, Kab. Badung, Bali. Beliau mendapat penghargaan di bidang Maestro Seni Tradisi. Penghargaan Kali ini diserahkan oleh Presiden Republik Indonesia Susilo Bambang Yudhoyono yang diwakili oleh Wakil Presiden Boediono beserta Menteri Kebudayaan dan Pariwisata Ir. Jero Wacik kepada perwakilan (alm.) Jero Puspawati yaitu Ida Ayu Wimba Ruspawati selaku putri sulung beliau.

Jero Puspawati adalah seorang seniman yang bergelut khusus di bidang seni tradisi Dramatari Arja. Dilahirkan sekitar 77 tahun yang lalu di Desa Pejeng, Kab. Gianyar, beliau terlahir dengan nama Ni Wayan Sembo. Sejak umur 7 tahun, beliau memulai karir berkesenian secara otodidak. Hal ini dipelajari langsung dari ayahnya yang bernama I Raos yang pada jamannya dikenal sebagai pemeran tokoh Pandung dalam dramatari Calonarang yang cukup populer karena penguasaan teknik serta penjiwaannya. Beliau sangat rajin mengikuti kiprah ayahnya pentas kesana-kemari demi sebuah pengalaman sekaligus menjalankan kegemarannya menyaksikan orang menari. Dari berbagai pengalaman-pengalaman menonton tersebutlah, secara tidak disadari ketajaman intuisinya akan seni tradisi menjadi terasah. Tak heran, ia pun dengan mudah menghafal urutan pementasan karakter-karakter yang terdapat dalam dramatari Arja.

Bakat emas ini ternyata cepat disadari oleh ayahnya kala itu. I Raos kemudian mengajarinya tembang-tembang Sekar Alit sebagai modal utama dalam memerankan tokoh dalam opera tradisional tersebut. Karena memang sudah memiliki potensi unggul, Ni Sembo tak membutuhkan waktu lama untuk menguasai berbagai pupuh yang diajarkan ayahnya. Selanjutnya, perjalanan karir keseniannya di dramatari Arja pun dimulai. Pelatihannya dimulai dari belajar tari Condong, lalu beralih ke Mantri Manis, Mantri Buduh, lalu berakhir di tokoh Limbur. Seiring dengan meningkatnya jam terbang pementasan beliau, maka semakin matanglah pengalaman di bidangnya. Pun demikian dengan kematangan penokohan karakter yang mulai mengarah secara spesifik. Setelah demikian lama berlatih dan pentas, akhirnya beliau dikenal cocok membawakan tokoh Mantri Buduh dan Limbur. Identitas pun disematkan oleh masyarakat kepada beliau sebagai Mantri Buduh Pejeng atau Limbur Pejeng, karena memang berasal dari Pejeng, Gianyar.

Karena kemampuan serta pengalamannya itulah, beliau sempat tergabung dengan berbagai seniman dramatari Arja yang terkenal dan pentas di seluruh Bali. Beliau sempat bergabung dalam grup Arja Singapadu yang disesaki oleh seniman-seniman besar seperti (alm.) Tjokorda Oka Tublen, (alm.) I Wayan Geria, (alm.) I Made Keredek, serta sering pentas bersama seniman besar (alm.) I Ketut Rindha dari Blahbatuh, Gianyar, (alm.) Jero Suli dari Denpasar serta pasangan punakawan (alm.) I Sadru dan (alm.) I Monjong dari Keramas, Gianyar. Dengan seniman-seniman tersebutlah, Ni Sembo sering bertukar pikiran, berdialog dan tanpa sungkan-sungkan menggali ilmu pada siapapun. Oleh karenanya, interaksi yang intensif dengan seniman berbagai karakter di luar desanya membuat Ni Sembo semakin diperhitungkan di jagat dramatari Arja pada jamannya.

Pada tahun 1952, Ni Sembo sempat mengadakan pentas tari Arja ke Lombok bersama grup ayahnya. Beliau kesana atas undangan komunitas Bali yang rindu akan seni tradisional di tanah leluhurnya. Di tempat inilah beliau bertemu dengan Ida Bagus Made Raka, seniman besar Bali yang berasal dari desa Bongkasa, kec. Abiansemal, Kab Badung. Mereka pun saling jatuh hati dan tak lama kemudian melangsungkan proses pernikahan. Ni Sembo resmi menikah ke Geriya Gede Bongkasa dan berganti nama menjadi Jero Puspawati. Karir keseniannya di bidang dramatari Arja bukannya terganjal karena menikah dan mengurusi rumah tangga, namun sebaliknya, justru semakin berkibar berkat dukungan sang suami. Ida Bagus Made Raka yang tak hanya dikenal tangguh sebagai Baris atau Jauk Bongkasa, juga dikenal sebagai juru kendang tari Arja yang sangat mahir. Atas prakarsa mereka berdua bersama Ida Pedanda Gede Putra Singarsa (alm.) yang juga dikenal sebagai Dalang Bongkasa pada masa lalu, terbentuklah grup kesenian Parwa Agung yang berbasis di desa Blahkiuh, Kec. Abiansemal, Kab. Badung. Grup ini sangat terkenal pada masanya dan hingga kini masih tetap eksis. Selain itu, mereka pun secara berpasangan mengabdikan diri memenuhi permintaan masyarakat di berbagai desa di Bali untuk mengajar dramatari Arja. Berdua, mereka merasakan indahnya kebersamaan tak hanya sebagai pasangan hidup, namun juga sebagai pasangan seniman yang sangat serasi dan bermental pengabdian yang sangat tulus.

Pada tahun 2002, sang suami yaitu Ida Bagus Made Raka berpulang menghadap Sang Pencipta karena sakit yang dideritanya. Tentu, kesedihan yang mendalam menghinggapi Jero Puspawati selaku pasangannya. Namun hal ini tak menyurutkan niat beliau untuk terus mengabdi di bidangnya secara professional. Hidup harus terus berlanjut dan tiada henti mengabdi. Setidaknya prinsip itulah yang menguatkan mental Jero Puspawati dalam melanjutkan sisa hidupnya. Terbukti, beliau didaulat oleh para anggota sekaa santi Gita Keheningan Banjar Kehen Kesiman untuk membina pesantian ini di bidang Sekar Alit. Senyum girang kembali menghiasi bibir beliau ketika mengingat sisa hidupnya yang masih memiliki guna dan manfaat bagi masyarakat sekitarnya.

 

 

 

Kepercayaan masyarakat di desa Kesiman (tempat domisili sementara beliau sepeninggal sang suami) kepada beliau semakin tebal ketika beliau didaulat menjadi duta Br. Kehen sebagai penari Joged Bumbung dalam parade pentas tari Joged Lansia yang digelar oleh Pemerintah Desa Kesiman Petilan pada tanggal 6 Februari 2011 yang lalu. Keceriaan beliau nampak jelas menghiasi hari tuanya. Menari seolah sebagai terapi kesehatan bagi beliau. Sesakit apapun tubuhnya, dapat dilupakan sejenak bilamana beliau mendengarkan lantunan pupuh Sekar Alit yang dikumandangkan oleh orang di sekitarnya maupun lewat siaran radio. Pun demikian ketika suatu waktu ada beberapa orang datang ke tempat beliau mendiskusikan masalah pakem tari Arja.

Akhirnya, Sabtu, 21 Mei 2011 beliau menghembuskan nafas terakhirnya karena sakit lever yang dideritanya dan sekaligus sebagai pertanda perpisahan beliau pada pengabdiannya di jagat seni tradisi Bali. Beliau meninggalkan dua orang putri yaitu Ida Ayu Wimba Ruspawati (51 th) dan Ida Ayu Mas Yuniari (47), serta enam orang cucu. Dua di antaranya merupakan tunas muda yang diharapkan dapat meneruskan pengabdian beliau di jagat seni, sesuai bidangnya masing-masing. Mereka adalah Ida Bagus Gede Surya Peradantha S.Sn., serta Ida Ayu Gede Sasrani Widyastuti. Ida Ayu Wimba Ruspawati selaku putri almarhum mengucapkan terima kasih kepada perhatian pemerintah pusat kepada seniman-seniman di Bali khususnya yang telah berjasa di bidangnya masing-masing. Ia berharap agar pemerintah tak henti-hentinya membangun usaha untuk memperhatikan keberadaan para seniman yang telah mengharumkan nama daerah dan bahkan negara di dunia internasional. Tak hanya TKI yang merupakan pahlawan devisa, namun seniman melakukan hal yang lebih sebagai media promosi potensi seni dan budaya seuatu negara.

 

Written by in: Tulisan |

Powered by WordPress | Theme: Aeros 2.0 by TheBuckmaker.com