Gender wayang

This post was written by dandipratama on Juli 18, 2018
Posted Under: Tak Berkategori

Gender wayang

Pengetahuan gender secara umum :
Gender wayang secara umum
Gender wayang adalah merupakan sebuah tungguhan berbilah dengan terampa yang terbuat dari kayu, sebagai alas dari resonator berbentuk silinder dari bahan bambu atau yang lebih dikenal dengan sebutan bumbung sebagai tempat menggantung bilahhttp://www.dailymotion.com/video/GENDER%20WAYANG. Bentuk tungguhan dari segi bilah gamelan Gender Wayang di sebutkan berbentuk bulig yaitu bilah yang terbuat dari perunggu atau bilah kalor adalah bilah yang permukannya menggunakan garis linggir (kalor) dan dalam buku ini juga disebutkan bilah ini biasa digunakan pada jenis-jenis tungguhan gangsa seperti halnya gamelan Gender Wayang. Bilah bulig adalah bentuk bilah yang digunakan di gamelan Gender Wayang secara umum di Bali. (“Ensiklopedi Karawitan Bali” karya Pande Made Sukerta)
Kemudian terampa ataupun pelawah dari gamelan Gender Wayang di Bali memiliki model atau bentuk yang sama, yaitu 2 (dua) buah adeg-adeg yang terbuat dari kayu berfungsi sebagai penyangga gantungan bilah dan tempat resonator atau bumbung. Meskipun secara umum model dan bentuknya sama, faktanya dari setiap daerah memiliki ciri khas dan keunikannya masing-masing sesuai dengan budaya seni dan kreativitas seniman di daerah setempat. Hal ini terletak pada ornamentasi yang berarti hiasan atau pepayasan. Unsur arsitektur yang merupakan induk dari ornamentasi dan pepayasan juga hadir sebagai bagian dari alat musik, yang berkaitan dengan bidang tertentu. Khususnya dalam gamelan Gender Wayang terlatak pada bidang terampa atau tungguhan. Setiap daerah di Bali memiliki sebuah persepsi yang tidak sama, walaupun berakar dari satu konsep style atau model lagu (gending) di masyarakat Bali.
Gender Wayang secara khusus
Gender wayang adalah barungan alit yang merupakan gamelan Pewayangan (Wayang kulit dan wayang wong) dengan instrumen pokoknya yang terdiri dari 4 tungguh gender berlaras slendro (lima nada). Keempat gender ini terdiri dari sepasang gender pemade (nada agak besar) dan sepasang gender kantilan (nada agak kecil). Keempat gender, masing-masing berbilah sepuluh bilah yang dimainkan dengan mempergunakan 2 panggul, Gambelan ini merupakan gambelan yang tergolong dalam gambelan golongan tua. Nada yang di gunakan adalah nada(patet) selendro .dan nada nya berawal dari nada berbilah besar bernada rendah ndang atau ndong dan berakhi di bilah nada yang kecil danbernada tinggi yaitu nada nding atau ndung,tergantung pemain yang memainkan.

FungsidanPeranan Gender wayang

Gender Wayangtidakhanyadikenalberfungsisebagaialatpengiringpertunjukanwayangjugasebagaialatmusik instrumental. Peranannyasebagaimusikinstrumentaldalamhalini, disampinguntukiringanupacarametatah (potonggigi), upacarangaben, RsiYadnyadan lain sebagainya, jugauntukmengiringipembacaankekawindankidung,misalnya : mantramTrisandya yang dapatkitadengarsaatpagi, siangdan sore diradiomaupunditelevisi, disana gender wayangsebagaipengiringdanmampumemberikansuasana ritual.Namalagusebagaipengiringnyaadalah ”Sekar Sumsang” gayaKayumas.Gender Wayangsudahmulaidigemariolehanak-anak, terbuktidenganbanyaknyaanak-anakyang berminat les/kursusmenabuh Gender Wayangterutamaanak-anaktingkat SD, SMP,SMA, bahkananak-anaksetingkat TK punsudahdiarahkanperhatianmerekabelajardanmengenalgending-gending gender wayang. Inimenjadisuatukebanggaanbagikitaterhadapgenerasimuda yang sudahmaubelajarmusik-musiktradisi Bali. Hal inijugasangatmenggembirakankarenamenempatkaninstrumenGender Wayangsejajardenganminatpadaalatmusiklainmisalnyagitar, piano dan drum. Peranan orang tuajugasangatbesardalammengarahkandanmendukungminatputradanputrinyapadakegiatan yang positif.Padasaatini, banyakterjadisalahpergaulanpadagenerasimudakita.Merekatidakmenyadaripotensidalamdirinya, namunmencariidentitasdiripadapergaulan yang salah.Disinilahperan orang tuauntukmengarahkandanmemberiperhatianapasebenarnya yang dibutuhkanputra-putrimereka. Salah satualternativeuntukmengisiwaktuluangmerekaadalahmengikutikursusprivat gender wayang.Instansipendidikansangatmenekankanpadakesadaranakannilai-nilaitradisionalpadaanakdidiknyaterutamapadaalatmusik gamelan. Untukmenampungdansebagaiajangkompetisi, makadiselenggarakanberbagailombabaikantarsekolahatapunumum.Lomba-lomba yang seringdiselenggarakan.Banyaksekolah yang menekankan prosespenyaringansiswabarupadaanak-anak yang memilikiprestasi di bidang Seni.Dari uraian di atas, terlihatbahwafungsidanperanan Gender Wayangsebagaisalahsatualatmusik Bali, dapatmengikutiperkembanganzamansehinggatetapeksis, disampingfungsidanperananlamanya yang tidakbolehditinggalkan. Usaha pelestarian gender wayangjugamemberidampakpositifterutamapadapengusaha gamelan karenasemakinbanyakperanangamelan gender wayangbaiklokalmaupunmancanegara. Murid-muridkursusprivat genderwayang, seringmenginginkanmemilikiseperangkat Gender Wayanguntukdirumahnya.Darisegiekonomi, harga gender wayangtidaklahterlalutinggidibandinginstrumenlain, sehinggadapatdijangkauolehpribadi.

Pelawah Atau Bentuk Gambelan Gender wayang
Di daerah Badung dan Denpasar memiliki sebuah keunikan tersendiri yaitu tungguhan pelawahnya bisa dilipat apabila sudah selesai dimainkan, hal ini menurut Bapak I Wayan Suweca, S.Skar dosen seni karawitan yang mengajar mata kuliah Filsafat Seni Karawitan dikatakan hal ini berkaitan denganCiwa Tattwa dan mengandung konsep Purusa dan Predana. Purusa dan Predana yaitu sebuah filsafat yang menguraikan dua hal yang berbeda apabila bersatu akan menghasilkan sebuah energi yang besar yang biasa disebut dengan lanang wadon atau laki perempuan (mata kuliah pengetahuan seni karawitan 1 semester 3 dengan Bapak I Wayan Suweca, S.SKar, di kampus ISI Denpasar, tanggal 9 Oktober 2012).
Walaupun bentuk dan model sama persis, pelawahnya di kedua daerah ini sudah dibubuhi dengan sedikit pepayasanpada adeg-adeg berupa beberapa jenis motif ukiran sebagai pemanis dan diberikan warna prada.

Asal usul
SetelahwawancaradenganBapak I WayanSuwecaSS,kar, menurutinformasi yang sayadapatkanadanyagambelan gender wayang di KayumasKajadimulaipada tahun 1932 di rumah Pan Madri ( sebutanbapakuntukanakpertama) , dimanaanggotanyaterdiridari Pan Madri ,Pan Kandra , Pan Rukidan Pan Runaadapuninstrumengambelantersebutmerupakanpinjamandarikeluarga Pan Madri di DesaPanjer , Denpasar Selatan oleh Pan Made Regeg. Kemudian Pan Madriinimembentuksekha gender wayang,sesudahitupadagenerasikeduaadapenambahanpemainyaitu I WayanKonolanataudipanggil Pan WecadandisaatitudibentukjugasekhabateluntukmengiringiWayang Ramayana yang anggotanyaterdiridarikeluargadaribanjarKayumasKajadanbanjarKaliungudansekhainiberkembangdengandipilihnyauntukmengiringidalang-dalangterkenaldi Denpasar seperti Ida BagusTegaldariTegal Denpasar , Ida kajaBagusBindu Dari Kesiman , Ida BagusNgurahdariBuduk , Ida BagusSuyogadariBongkasedanmasihbanyakdalang-dalangterkenallainnya. Dengandipilihnyasebagaijurupengiringwayangkulitsekhainibanyaksekalimendapatpengalamandaridalang-dalang yang diiringikarenamempunyai style-style sendiri- sendiri .Gender WayangKayumasKajamemiliki style yaitu style has KayumasKajamisalnyadaribentuk gender wayangdanlagu-lagunya ,setelah gender initrusdipakaiuntukmengiringiakhirnyadikembalikanlagike Pan Madridanpadatahun 1948 meminjamkeTampakGangsuloleh orang yang terpandangdariTampakGangsulmenurutsejarahnya gender dariTampakgangsulinihadiahdariKerajaan Bali di Denpasar yang kualitasnyasangatbaikdanmetaksu. Dengandipakainya gender itusemakinterkenallah gender kayumas di daerahbadungdansekitarnya ,kemudiankarenabanyaksekalimengiringipewayanganmakapadatahun 1972 gender tersebutdikembalikankarena gender tersebuttidakbolehdipinjamkanlagikarenapadasaatitu di TampakGangsulsedangkacaubalau,makapadasaatitujuga Pan Wecamembuatlagitetapidengan style nyasendiridenganmeniru style gender di TampakGangsuldaribentuk , larassesuaidenganaslinya ,daun gender dibuatolehPandeMiegdariTiingan ,Klungkungdanpelawahnyaoleh Pan Wecasendiri . SejakitulahPanWecaselakupimpinansekha gender wayang di KayumasKajamembuat gender KhasKayumaskajauntuk di jualbelikan ,sampaisekarang gender wayang di kayumassudahdigenerasikanolehanakdancucudari pan Wecadantetapeksissampaisaatinidandikenal di daerah Bali maupun di luar Bali. Adapuninstrumen yang dipakaiadalah 2 tungguhpemadedan 2 tungguhkantil ,plawahnya style bebadunganyaituplawah gender wayangtidakadatatakanataupanyangga di bawahnyakarenaadaunsur-unsurfilosofi yang terkandungpada instrument tersebutkarenakayu yang dipakaipada gender ituadalahkayu “Las Celagi” karenadipercayakayutersebutmemilikinilai-nilaimistis dan awet jarang pula di makan binatang tani.

Yang mempunyai pertama kali gender wayang di Desa Panjer
Kak Puger dari Banjar kaja panjer ( dilupakan )
Pan Sukaja dari Banjar kangin panjer (dilupakan )
Pan Dayuh dari banjar antap panjer ( dilupakan )
Pan Raput dari banjar bekul panjer (dilupakan )
Kak Gembur dari banjar kaja panjer ( 1902 )
I Gusti made anom S.Ag ( 1986 )
Add a Comment
Logged in as dandipratama.

Add a Comment

required, use real name
required, will not be published
optional, your blog address