Seldet bebarongan

Gender wayang

Gender wayang

Pengetahuan gender secara umum :
Gender wayang secara umum
Gender wayang adalah merupakan sebuah tungguhan berbilah dengan terampa yang terbuat dari kayu, sebagai alas dari resonator berbentuk silinder dari bahan bambu atau yang lebih dikenal dengan sebutan bumbung sebagai tempat menggantung bilahhttp://www.dailymotion.com/video/GENDER%20WAYANG. Bentuk tungguhan dari segi bilah gamelan Gender Wayang di sebutkan berbentuk bulig yaitu bilah yang terbuat dari perunggu atau bilah kalor adalah bilah yang permukannya menggunakan garis linggir (kalor) dan dalam buku ini juga disebutkan bilah ini biasa digunakan pada jenis-jenis tungguhan gangsa seperti halnya gamelan Gender Wayang. Bilah bulig adalah bentuk bilah yang digunakan di gamelan Gender Wayang secara umum di Bali. (“Ensiklopedi Karawitan Bali” karya Pande Made Sukerta)
Kemudian terampa ataupun pelawah dari gamelan Gender Wayang di Bali memiliki model atau bentuk yang sama, yaitu 2 (dua) buah adeg-adeg yang terbuat dari kayu berfungsi sebagai penyangga gantungan bilah dan tempat resonator atau bumbung. Meskipun secara umum model dan bentuknya sama, faktanya dari setiap daerah memiliki ciri khas dan keunikannya masing-masing sesuai dengan budaya seni dan kreativitas seniman di daerah setempat. Hal ini terletak pada ornamentasi yang berarti hiasan atau pepayasan. Unsur arsitektur yang merupakan induk dari ornamentasi dan pepayasan juga hadir sebagai bagian dari alat musik, yang berkaitan dengan bidang tertentu. Khususnya dalam gamelan Gender Wayang terlatak pada bidang terampa atau tungguhan. Setiap daerah di Bali memiliki sebuah persepsi yang tidak sama, walaupun berakar dari satu konsep style atau model lagu (gending) di masyarakat Bali.
Gender Wayang secara khusus
Gender wayang adalah barungan alit yang merupakan gamelan Pewayangan (Wayang kulit dan wayang wong) dengan instrumen pokoknya yang terdiri dari 4 tungguh gender berlaras slendro (lima nada). Keempat gender ini terdiri dari sepasang gender pemade (nada agak besar) dan sepasang gender kantilan (nada agak kecil). Keempat gender, masing-masing berbilah sepuluh bilah yang dimainkan dengan mempergunakan 2 panggul, Gambelan ini merupakan gambelan yang tergolong dalam gambelan golongan tua. Nada yang di gunakan adalah nada(patet) selendro .dan nada nya berawal dari nada berbilah besar bernada rendah ndang atau ndong dan berakhi di bilah nada yang kecil danbernada tinggi yaitu nada nding atau ndung,tergantung pemain yang memainkan.

FungsidanPeranan Gender wayang

Gender Wayangtidakhanyadikenalberfungsisebagaialatpengiringpertunjukanwayangjugasebagaialatmusik instrumental. Peranannyasebagaimusikinstrumentaldalamhalini, disampinguntukiringanupacarametatah (potonggigi), upacarangaben, RsiYadnyadan lain sebagainya, jugauntukmengiringipembacaankekawindankidung,misalnya : mantramTrisandya yang dapatkitadengarsaatpagi, siangdan sore diradiomaupunditelevisi, disana gender wayangsebagaipengiringdanmampumemberikansuasana ritual.Namalagusebagaipengiringnyaadalah ”Sekar Sumsang” gayaKayumas.Gender Wayangsudahmulaidigemariolehanak-anak, terbuktidenganbanyaknyaanak-anakyang berminat les/kursusmenabuh Gender Wayangterutamaanak-anaktingkat SD, SMP,SMA, bahkananak-anaksetingkat TK punsudahdiarahkanperhatianmerekabelajardanmengenalgending-gending gender wayang. Inimenjadisuatukebanggaanbagikitaterhadapgenerasimuda yang sudahmaubelajarmusik-musiktradisi Bali. Hal inijugasangatmenggembirakankarenamenempatkaninstrumenGender Wayangsejajardenganminatpadaalatmusiklainmisalnyagitar, piano dan drum. Peranan orang tuajugasangatbesardalammengarahkandanmendukungminatputradanputrinyapadakegiatan yang positif.Padasaatini, banyakterjadisalahpergaulanpadagenerasimudakita.Merekatidakmenyadaripotensidalamdirinya, namunmencariidentitasdiripadapergaulan yang salah.Disinilahperan orang tuauntukmengarahkandanmemberiperhatianapasebenarnya yang dibutuhkanputra-putrimereka. Salah satualternativeuntukmengisiwaktuluangmerekaadalahmengikutikursusprivat gender wayang.Instansipendidikansangatmenekankanpadakesadaranakannilai-nilaitradisionalpadaanakdidiknyaterutamapadaalatmusik gamelan. Untukmenampungdansebagaiajangkompetisi, makadiselenggarakanberbagailombabaikantarsekolahatapunumum.Lomba-lomba yang seringdiselenggarakan.Banyaksekolah yang menekankan prosespenyaringansiswabarupadaanak-anak yang memilikiprestasi di bidang Seni.Dari uraian di atas, terlihatbahwafungsidanperanan Gender Wayangsebagaisalahsatualatmusik Bali, dapatmengikutiperkembanganzamansehinggatetapeksis, disampingfungsidanperananlamanya yang tidakbolehditinggalkan. Usaha pelestarian gender wayangjugamemberidampakpositifterutamapadapengusaha gamelan karenasemakinbanyakperanangamelan gender wayangbaiklokalmaupunmancanegara. Murid-muridkursusprivat genderwayang, seringmenginginkanmemilikiseperangkat Gender Wayanguntukdirumahnya.Darisegiekonomi, harga gender wayangtidaklahterlalutinggidibandinginstrumenlain, sehinggadapatdijangkauolehpribadi.

Pelawah Atau Bentuk Gambelan Gender wayang
Di daerah Badung dan Denpasar memiliki sebuah keunikan tersendiri yaitu tungguhan pelawahnya bisa dilipat apabila sudah selesai dimainkan, hal ini menurut Bapak I Wayan Suweca, S.Skar dosen seni karawitan yang mengajar mata kuliah Filsafat Seni Karawitan dikatakan hal ini berkaitan denganCiwa Tattwa dan mengandung konsep Purusa dan Predana. Purusa dan Predana yaitu sebuah filsafat yang menguraikan dua hal yang berbeda apabila bersatu akan menghasilkan sebuah energi yang besar yang biasa disebut dengan lanang wadon atau laki perempuan (mata kuliah pengetahuan seni karawitan 1 semester 3 dengan Bapak I Wayan Suweca, S.SKar, di kampus ISI Denpasar, tanggal 9 Oktober 2012).
Walaupun bentuk dan model sama persis, pelawahnya di kedua daerah ini sudah dibubuhi dengan sedikit pepayasanpada adeg-adeg berupa beberapa jenis motif ukiran sebagai pemanis dan diberikan warna prada.

Asal usul
SetelahwawancaradenganBapak I WayanSuwecaSS,kar, menurutinformasi yang sayadapatkanadanyagambelan gender wayang di KayumasKajadimulaipada tahun 1932 di rumah Pan Madri ( sebutanbapakuntukanakpertama) , dimanaanggotanyaterdiridari Pan Madri ,Pan Kandra , Pan Rukidan Pan Runaadapuninstrumengambelantersebutmerupakanpinjamandarikeluarga Pan Madri di DesaPanjer , Denpasar Selatan oleh Pan Made Regeg. Kemudian Pan Madriinimembentuksekha gender wayang,sesudahitupadagenerasikeduaadapenambahanpemainyaitu I WayanKonolanataudipanggil Pan WecadandisaatitudibentukjugasekhabateluntukmengiringiWayang Ramayana yang anggotanyaterdiridarikeluargadaribanjarKayumasKajadanbanjarKaliungudansekhainiberkembangdengandipilihnyauntukmengiringidalang-dalangterkenaldi Denpasar seperti Ida BagusTegaldariTegal Denpasar , Ida kajaBagusBindu Dari Kesiman , Ida BagusNgurahdariBuduk , Ida BagusSuyogadariBongkasedanmasihbanyakdalang-dalangterkenallainnya. Dengandipilihnyasebagaijurupengiringwayangkulitsekhainibanyaksekalimendapatpengalamandaridalang-dalang yang diiringikarenamempunyai style-style sendiri- sendiri .Gender WayangKayumasKajamemiliki style yaitu style has KayumasKajamisalnyadaribentuk gender wayangdanlagu-lagunya ,setelah gender initrusdipakaiuntukmengiringiakhirnyadikembalikanlagike Pan Madridanpadatahun 1948 meminjamkeTampakGangsuloleh orang yang terpandangdariTampakGangsulmenurutsejarahnya gender dariTampakgangsulinihadiahdariKerajaan Bali di Denpasar yang kualitasnyasangatbaikdanmetaksu. Dengandipakainya gender itusemakinterkenallah gender kayumas di daerahbadungdansekitarnya ,kemudiankarenabanyaksekalimengiringipewayanganmakapadatahun 1972 gender tersebutdikembalikankarena gender tersebuttidakbolehdipinjamkanlagikarenapadasaatitu di TampakGangsulsedangkacaubalau,makapadasaatitujuga Pan Wecamembuatlagitetapidengan style nyasendiridenganmeniru style gender di TampakGangsuldaribentuk , larassesuaidenganaslinya ,daun gender dibuatolehPandeMiegdariTiingan ,Klungkungdanpelawahnyaoleh Pan Wecasendiri . SejakitulahPanWecaselakupimpinansekha gender wayang di KayumasKajamembuat gender KhasKayumaskajauntuk di jualbelikan ,sampaisekarang gender wayang di kayumassudahdigenerasikanolehanakdancucudari pan Wecadantetapeksissampaisaatinidandikenal di daerah Bali maupun di luar Bali. Adapuninstrumen yang dipakaiadalah 2 tungguhpemadedan 2 tungguhkantil ,plawahnya style bebadunganyaituplawah gender wayangtidakadatatakanataupanyangga di bawahnyakarenaadaunsur-unsurfilosofi yang terkandungpada instrument tersebutkarenakayu yang dipakaipada gender ituadalahkayu “Las Celagi” karenadipercayakayutersebutmemilikinilai-nilaimistis dan awet jarang pula di makan binatang tani.

Yang mempunyai pertama kali gender wayang di Desa Panjer
Kak Puger dari Banjar kaja panjer ( dilupakan )
Pan Sukaja dari Banjar kangin panjer (dilupakan )
Pan Dayuh dari banjar antap panjer ( dilupakan )
Pan Raput dari banjar bekul panjer (dilupakan )
Kak Gembur dari banjar kaja panjer ( 1902 )
I Gusti made anom S.Ag ( 1986 )
Add a Comment
Logged in as dandipratama.

Pengertian Tabuh lelambatan

Tabuh lelambatan pegongan merupakan salah satu komposisi klasik dalam seni karawitan Bali. Dari berbagai bentuk komposisi yang ada, komposisi ini memiliki spesifikasi dan ciri khas tersendiri dimana penekanan pada istilah ”lelambatan” mencerminkan sebuah identitas yang kuat. Lelambatan berasal dari kata Lambat yang berarti pelan yang mendapat awalan Le dan akhiran an kemudian menjadi lelambatan yang berarti komposisi lagu yang dimainkan dengan tempo dan irama yang lambat/pelan. Tambahan kata Pegongan pada bagian belakang kata Lelambatan sebagai penegasan pengertian bahwa gending-gending lelambatan klasik pagongan adalah merupakan repertoar dari gending-gending yang dimainkan dengan memakai barungan gamelan Gong. Gamelan Gong yang dimaksud adalah gamelan-gamelan yang tergolong dalam kelompok barungan yang memiliki Patutan Gong. Patutan adalah merupakan istilah yang dipergunakan untuk menyebutkan tangga nada (laras) gamelan Bali yang mempergunakan laras pelog 5 (lima) nada.

Diantara barungan gamelan yang berlaras pelog lima nada, yang biasanya dipergunakan untuk menyajikan tabuh-tabuh lelambatan adalah gamelan Gong Gede dan Gamelan Gong Kebyar. Dari kedua barungan tersebut secara khusus tabuh-tabuh lelambatan adalah merupakan repertoar dari barungan Gamelan Gong Gede.

Sebagai sebuah komposisi karawitan klasik, keberadaannya sudah cukup lama dalam blantika musik tradisional Bali. terkait dengan keberadaannya itu, hingga saat ini belum ada data akurat yang mengungkap awal mula keberadaan tabuh-tabuh lelambatan klasik pegongan. Namun demikian, sebagai bagian dari repertoar gamelan Gong Gede, keberadaan gamelan tersebut dapat dipakai acuan sementara terkait dengan awal mula keberadaan komposisi-komposisi tabuh lelambatan tersebut.

Gamelan Gong Gede diduga mengalami puncak perkembangannya pada abad ke XVI-XVII yaitu pada masa pemerintahan Dalem Waturenggong. Raja sebagai patronase pada waktu itu menunjukkan supremasinya melalui pembinaan berbagai bentuk kesenian termasuk diantaranya gamelan Gong Gede (Astita dalam Mudra, 1995:120). Abad tersebut dianggap sebagai jaman keemasan kesenian Bali, dimana pada waktu itu banyak bermunculan berbagai jenis seni pertunjukan tradisional baik berupa tari, karawitan dan pewayangan.

Secara filosifis, tabuh sebagaimana diuraikan dalam prekempa (Bandem, 1986:65) bait ke 36 ada disebutkan:

”Iti pretyakaning tabuh. Tabuh kang inaran tata ing buh. Tata ngaran prawerti. Prawerti ngaran kasusilan, susila ngaran sesana mwang penglaksana. Apan wiwiting hana wyaktinya sangkaning tiga, apan Sang Hyang Tri Wisesa angadakaken salwiring tumuwuh mwang salwiring maurip. Iti hana Sang Hyang Buh loka yaika sangkaning payoganira Sang Hyang Tri Wisesa kang gumawe utpeti, sthiti pralina….”.

Artinya:

”…Inilah keterangan dari susunan tabuh. Tabuh berasal dari tata dan buh. Tata yang disebut prawerti, prawerti artinya kesusilaan, susila yang berarti sesana dan pelaksana. Karena asal mula yang sebenarnya berasal dari tiga, karena Sang Hyang Tri Wisesa yang mengadakan segala yang tumbuh dan segala yang  berjiwa…”

Dari uraian tersebut dapat dicermati bahwa tabuh mengandung pemaknaan yang cukup dalam mengenai ajaran tata susila serta konsepsi tentang kelahiran, kehidupan dan kematian yang merupakan siklus kehidupan manusia di dunia. Di dalam konteks seni karawitan, tabuh diuraikan sebagai suatu bentuk komposisi karawitan yang disajikan melalui media seperangkat gamelan Bali baik intrumentalia dan sebagai musik pengiring tari, drama, prosesi dan sebagainya (Kamus Bali-Indonesia (1978:555).

Di lain pihak, I Nyoman Rembang (1984/1985:8-9) secara spesifik memberikan penjelasan bahwa tabuh bila dilihat sebagai suatu estetika teknik penampilan adalah hasil kemampuan seniman mencapai keseimbangan permainan dalam mewujudkan suatu repertoir hingga sesuai dengan jiwa, rasa dan tujuan komposisi. Sedangkan, tabuh sebagai suatu bentuk komposisi, juga dapat diartikan sebagai kerangka dasar gending-gending lelambatan tradisional Misalnya tabuh pisan, tabuh dua, tabuh telu, tabuh pat dan sebagainya.

Karawitan di Era Modern

Sejak tahun 1950an, Karawitan digunakan untuk menyebut seni suara berkembang di Nusantara, yang kedudukannya sejajar dengan musik. Karawitan tidak bisa dipandang sebelah mata jika dibandingkan dengan musik pada era modern ini, karena karawitan bisa melakukan apa yang tidak bisa dilakukan oleh musik pada era modern ini. Sebagai contoh, musik dalam jumlah banyak seperti orkestra, memerlukan seorang orang konduktor untuk menyamakan irama, tetapi sebaliknya, pada karawitan tidak diperlukan konduktor untuk menyamakan irama. Bisa dikatakan, karawitan adalah salah satu maha karya kebudayaan dari Nusantara.

Ironis memang, jika kita melihat perkembangan karawitan di era modern ini, abad 21. Andai dilakukan survei dalam bentuk tanya jawab pada anak-anak muda sekarang ini, bisa ditebak, “bisa dihitung dengan jari” anak-anak muda yang mengerti tentang karawitan.

Namun, hal terbalik malah terjadi di luar negeri. Karawitan berkembang pesat ! Sebuah fakta menggembirakan sekaligus mencengangkan, sebuah acara menempatkan gamelan sebagai menu utama festival diselenggarakan di Vancouver Kanada, bukan di Jawa yang merupakan daerah asal kebudayaan karawitan.

Hal tersebut tidak lepas dari “semakin jauhnya” generasi muda di Indonesia terhadap karawitan. Karawitan tidak lagi menjadi menu sehari-hari anak muda. Karawitan menjadi hal yang langka dan “terlarang” bagi kalangan muda. “Enggak gaul loe, anak muda selera musiknya kayak embah-embah” Sebuah celetukan yang mungkin didapatkan bagi penggemar muda karawitan di tengah anak-anak band.

Akses yang sulit juga berpengaruh terhadap perkembangan karawitan di Indonesia. Sedikit bercerita, pada pertengahan bulan Desember lalu, saya menjadi pendamping karya wisata yang umumnya disebut dengan piknik di sebuah SD di Kecamatan Nogosari. Pada awal keberangkatan, tidak terjadi hal yang aneh, biasa-biasa saja, anak-anak masih menyanyikan bersama-sama lagu anak-anak yang dipandu oleh guru di bus. Ketika perjalanan sudah cukup jauh, aktivitas menyanyi pun dihentikan, karena sudah capek juga. Dan lagu anak-anak pun digantikan dengan musik dangdut sesuai permintaan dari anak-anak. Ayah, satu dua lagu saya cukup mengerti, karena memang sudah familia. Anak-anak pun dengan senangnya ikut menyanyi menirukan lagu yang diputar di VCD.

Hal “aneh” pun terjadi, selama kurang lebih 3 jam non stop anak-anak masih menyanyi menirukan lantunan musik dari VCD ! Dan mereka hafal sebagian besar liriknya, yang bahkan saya sendiri pun tidak tahu lagu apa yang sedang diputar !

Hal yang cukup mencengangkan bukan ? Dan kita bisa menebak, di rumah dan di lingkungan anak-anak tersebut pasti musik-musik dangdut itu mudah sekali ditemukan dan sering kali diputar, yang berdampak membudayanya musik dangdut di kalangan anak-anak.

Tetapi hal tersebut tidak terjadi di karawitan pada era sekarang ini. Sekali lagi, karawitan begitu jauh dan begitu langka bagi generasi muda bangsa Indonesia. Padahal, jika dilihat dari segi kebermanfaatan dan nilai-nilai yang dikandung dalam karawitan jauh sekali lebih tinggi dibandingkan dengan musik dangdut. Andaikan saja musik karawitan yang membudaya, bukan musik dangdut, mungkin mental generasi muda bangsa ini menjadi lebih baik.

Selanjutnya, tentang fungsi. “Selama masih mempunyai fungsi, bisa dikatakan hidup dan berkembang”, kata Bapak Joko Daryanto. Karawitan sendiri mempunyai dua yaitu fungsi sosial dan fungsi musikal. Fungsi sosial karawitan yaitu digunakan untuk mendukung peristiwa atau kejadian di luar kesenian atau berkaitan dengan adat, contohnya digunakan ketika pernikahan, sekatenan, dll. Sedangkan fungsi musikal karawitan yaitu digunakan untuk mendukung kesenian yang lain, contohnya digunakan dalam pewayangan, karawitan teater, karawitan tari, konser karawitan mandiri dll.

Dalam perkembangannya, fungsi sosial dari karawitan mulai tergantikan dengan seni musik yang lebih “simpel”. Jika zaman dahulu ketika sunatan, kalau syukurannya belum anggap wayang, yang di dalamnya ada karawitan, belum marem rasanya. Tetapi, zaman sekarang ini, syukuran sudah marem hanya dengan memutar rekaman VCD. Fungsi kesenian dari karawitan di Indonesia pun berjalan kurang optimal, masih kalah dengan konser-konser band.

Dengan melihat potensi-potensi dari karawitan, karawitan harus tetap dilestarikan dan dibudayakan di kalangan anak muda, meskipun banyak permasalahan dan kendala.

Upaya yang bisa dilakukan, terutama sebagai calon guru sekolah dasar, adalah dengan memberikan pengetahuan-pengetahuan tentang karawitan. Sebuah upaya yang mainstream, tetapi cukup efektif menjawab pertanyaan tentang apa yang haru dilakukan.

Upaya yang lain yaitu mengajak anak-anak menonton konser karawitan, wayang kulit, wayang orang, sendra tari, atau sekatenan. Dengan intensitas yang lumayan rutin, diharapkan kecintaan siswa semakin meningkat.

Tetapi upaya-upaya tersebut hanyalah upaya untuk mempertahankan ke eksisan karawitan secara sementara. Jika ingin karawitan lebih eksisi lagi, dukungan total dari pemerintah sangat berpengaruh sekali, seperti pembuatan peraturan tentang wajibnya setiap sekolah terdapat ekstrakulikuler karawitan, mengadakan perangkat karawitan bagi setiap sekolah, dll.

Keberhasilan dalam mempertahankan karawitan harus dilakukan bersama-sama antara masyarakat dan pemerintah. Maka, kita sebagai bagaikan dari masyarakat akademis, mari kita mulai melangkahkan kaki mengawali upaya regenerasi dan transfer of knowledge kebudayaan karawitan kepada generasi muda bangsa Indonesia.

 

SEJARAH GAMBELAN/MUSIK GAMBANG DI BALI

Gamelan Gambang

Timbulnya Gambelan Gambang di Banjar Sembuwuk Desa Pejeng Kaja ini sudah ada sejak dahulu, yang merupakan warisan leluhurnya (tetamian). Pada jaman kerajaan Tabanan, salah seorang dari keluarga “Arya Simpangan” (sekaa gambang sekarang) tinggal di kerajaan Tabanan. Setelah terjadi perebutan kekuasaan, maka kerajaan Tabanan dibagi menjadi dua. Atas petunjuk Dalem Watu Renggong (Raja Gelgel, Gusti Ngurah Klating adik Gusti Ngurah Tabanan diberi tugas oleh Dalem untuk membuat Gambelan Gambang yang gending-gendinya diambil dari lontar pemberian “wong gamang” (orang halus).

Gambelan ini oleh petunjuk Dalem dipergunakan sebagai sarana perlengkapan di dalam upacara Ngaben (Pitra Yadnya). Maka sejak saat itu atau petunjuk I Gusti Ngurah Klating, mulailah orang-orang mempergunakan Gambelan Gambang didalam pelaksanaan upacara Ngaben.

Salah seorang keluarga Arya Simpangan, merasa tertarik untuk ikut membuat Gambelan Gambang tersebut, kemudian pulang ke Sembuwuk memberitahukan keluarganya tentang adanya gembelan tersebut dan sepakat untuk membuatnya.

Maka sejak saat itu mulailah di Banjar Sembuwuk ada gambelan Gambang yang pada mulanya hanya dipergunakan untuk upacara Ngaben (Rundah, wawancara, tanggal 5-11-1986, dalam Saptanaya, I Nyoman, 1986:13).

Keterangan ini diperkuat oleh Cokorda Agung Suyasa dari Puri Saren Ubud, yang menyimpan sebuah lontar tentang sejarah gambelan Gambang. Cokorda Agung Suyasa menerangkan sebagai berikut: Disebutkan pada jaman kerajaan Dalem Watu Renggong (1460 – 1550) di Tabanan ada sebuah kerajaan. Pada waktu itu raja mempunyai dua orang putra yaitu I Gusti Ngurah Tabanan dan adiknya I Gusti Ngurah Klating. Karena beliau sudah tua, maka kedudukan beliau diberikan kepada putranya yang pertama yaitu I Gusti Ngurah Tabanan. Oleh adiknya I Gusti Ngurah Klating hal itu tidak mau diterima, karena beliau juga menginginkan kedudukan tersebut. Maka terjadilah perang antara kakak dan adik dalam memperebutkan kedudukan sebagai raja. Kejadian itu lalu didengar oleh Dalem Watu Renggong, dan Gusti Ngurah Klating dipanggil untuk diminta keterangannya. Dalam keterangan itu Gusti Ngurah Klating mengakui bahwa dirinya memang menginginkan kedudukan itu, sehingga terjadilah perang.

Oleh Dalem permintaan Gusti Ngurah Klating bisa dipenuhi, dengan syarat Gusti Ngurah Klating harus menyelesaikan dulu tugas yang akan diberikan kepadanya. Kemudian Gusti Ngurah Klating diberi tugas oleh Dalem untuk mencari lontar milik wong gamang, yaitu lontar “tanpa sastra“ (tanpa tulisan) dan hanya diberi waktu selama tujuh hari. Kalau tidak berhasil maka Gusti Ngurah Klating akan dikenakan hukuman mati, dan seandainya berhasil nantinya akan diberi kedudukan sebagai raja. Dalem berkeyakinan bahwa tugas itu sudah pasti tidak dapat dipenuhi, karena hal itu hanya merupakan hukuman saja.

Dengan perasaan ragu-ragu Gusti Ngurah Klating berangkat mememnuhi permintaan Dalem. Gusti Ngurah Klating juga berkeyakinan bahwa hal itu tidak mungkin untuk dipenuhi. Segala tempat yang keramat dikunjunginya, tetapi dari sekian tempat yang sudah dikunjungi satupun tidak ada menunjukan tanda bahwa itu ada lontar yang dimaksud oleh Dalem.

Pada hari terakhir (hari ketujuh) siang hari saat matahari dengan teriknya memancarkan sinar, Gusti Ngurah Klating merasa kepanasan, sehingga timbul niatnya untuk mencoba berteduh yang kebetulah pada waktu itu menjumpaui pohon kepuh yang sangat besar terletak disebuah kuburan. Kemudian sambil merebahkan diri, Gusti Ngurah Klating mencoba untuk tidur. Pada saat itu entah dari mana datanglah burung gagak yang jumlahnya sangat banyak mengitari pohon kepuh tersebut sambil mengibas-ngibaskan sayapnya. Gusti Ngurah Klating kemudian terbangun dan melihat burung gagak yang sangat banyak itu. Dari kerumunan burung gagak itu kemudian jatuh sebuah lontar tepat dihadapan Gusti Ngurah Klating. Lontar tersebut lalu diambil dan setelah digenggam, kembali Gusti Ngurah Klating mencari-cari dimana burung gagak tersebut berada, tetapi ternyata sudah hilang.

Dengan didapatnya lontar tersebut, Gusti Ngurah Klating kembali ke Gelgel untuk menghadap Dalem tanpa memeriksa apa isinya. Di Gelgel Dalem menyambut kedatangan Gusti Ngurah Klating dengan dugaan bahwa tugas itu sudah pasti tidak dapat dipenuhi. Gusti Ngurah Klating menghadap dan menceritakan kejadian yang baru saja dialaminya, serta menghaturkan lontar yang telah didapatnya.

Dalem kemudian memeriksa isi lontar tersebut, dan betapa terkejutnya karena lontar lontar tersebutlah yang sebenarnya diminta oleh Dalem. Karena janjinya untuk menobatkan Gusti Ngurah Klating sebagai raja, maka kerajaan kaka Gusti Ngurah Klating (I Gusti Ngurah Tabanan) lalu dibagi menjadi dua. Sebelum dinobatkan menjadi raja, Gusti Ngurah Klating disuruh oleh Dalem untuk membuat seperangkat gambelsn yang gending-gendinya diambil dari lontar tersebut.

Karena gending-gending tersebut diambil dari lontar milik wong gamang, maka barungan gambelan tersebut oleh Dalem diberi nama gambelan gambang yang dipergunakan untuk mengiringi jalannya upacara.

Sebelum dimainkan gambelan tersebut diberikan sesajen dengan tujuan untuk dihaturkan kepada wong gamang agar tidak menggagu jalannya upacara. Maka sejak saat itulah di Bali berkembang Gambelan Gambang yang dipergunakan sebagai sarana pelengkap di dalam melakukan upacara atau yadnya.